SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61895_P050
Price: $0.00
SKU
ARP61895_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Pkn2 (ARP61895_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pkn2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 77%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE
Concentration0.5 mg/ml
Blocking PeptideFor anti-Pkn2 (ARP61895_P050) antibody is Catalog # AAP61895
Gene SymbolPkn2
Gene Full Nameprotein kinase N2
Alias SymbolsPR, Prk, Stk, PRK2, Stk7, Prkcl2, AI507382, 6030436C20Rik
NCBI Gene Id109333
Protein NameSerine/threonine-protein kinase N2
Description of TargetPkn2 is a PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. It plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Pkn2 phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associate with filamentous actin, phosphorylates HDAC5, therefore lead to impair HDAC5 import. It is a direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells and is required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. It stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation, regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion, inhibits Akt pro-survival-induced kinase activity. It mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF).
Uniprot IDQ8BWW9
Protein Accession #NP_848769
Nucleotide Accession #NM_178654
Protein Size (# AA)983
Molecular Weight111kDa
  1. What is the species homology for "Pkn2 Antibody - C-terminal region (ARP61895_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "Pkn2 Antibody - C-terminal region (ARP61895_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Pkn2 Antibody - C-terminal region (ARP61895_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Pkn2 Antibody - C-terminal region (ARP61895_P050)"?

    This target may also be called "PR, Prk, Stk, PRK2, Stk7, Prkcl2, AI507382, 6030436C20Rik" in publications.

  5. What is the shipping cost for "Pkn2 Antibody - C-terminal region (ARP61895_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Pkn2 Antibody - C-terminal region (ARP61895_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Pkn2 Antibody - C-terminal region (ARP61895_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "111kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Pkn2 Antibody - C-terminal region (ARP61895_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PKN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PKN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PKN2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PKN2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PKN2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PKN2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Pkn2 Antibody - C-terminal region (ARP61895_P050)
Your Rating
We found other products you might like!