SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61794_P050
Price: $0.00
SKU
ARP61794_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Pdgfc (ARP61794_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pdgfc
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV
Concentration0.5 mg/ml
Blocking PeptideFor anti-Pdgfc (ARP61794_P050) antibody is Catalog # AAP61794
Gene SymbolPdgfc
Gene Full Nameplatelet derived growth factor C
Alias SymbolsPDGF-, SCDGF, PDGF-C, VEGF-E, AI647969, 1110064L01Rik
NCBI Gene Id54635
Protein NamePlatelet-derived growth factor C
Description of TargetGrowth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. Required for normal skin morphogenesis during embryonic development. Plays an important role in wound healing, where it appears to be involved in three stages: inflammation, proliferation and remodeling. Plays an important role in angiogenesis and blood vessel development. Involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain has mitogenic activity in coronary artery smooth muscle cells, suggesting a role beyond the maintenance of the latency of the PDGF domain. In the nucleus, PDGFC seems to have additional function.
Uniprot IDQ8CI19
Protein Accession #NP_064355
Nucleotide Accession #NM_019971
Protein Size (# AA)345
Molecular Weight39kDa
  1. What is the species homology for "Pdgfc Antibody - N-terminal region (ARP61794_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Horse, Rabbit".

  2. How long will it take to receive "Pdgfc Antibody - N-terminal region (ARP61794_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Pdgfc Antibody - N-terminal region (ARP61794_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Pdgfc Antibody - N-terminal region (ARP61794_P050)"?

    This target may also be called "PDGF-, SCDGF, PDGF-C, VEGF-E, AI647969, 1110064L01Rik" in publications.

  5. What is the shipping cost for "Pdgfc Antibody - N-terminal region (ARP61794_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Pdgfc Antibody - N-terminal region (ARP61794_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Pdgfc Antibody - N-terminal region (ARP61794_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Pdgfc Antibody - N-terminal region (ARP61794_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PDGFC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PDGFC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PDGFC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PDGFC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PDGFC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PDGFC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Pdgfc Antibody - N-terminal region (ARP61794_P050)
Your Rating
We found other products you might like!