- Description of Target:
- The function of this protein remains unknown.
- Gene Symbol:
- Taf6l
- Official Gene Full Name:
- TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor
- Alias Symbols:
- Taf6l
- Tissue Tool:
- Find tissues and cell lines supported to express Taf6l.
- Protein Accession# :
- NP_001101045
- Nucleotide Accession#:
- NM_001107575
- Swissprot Id:
- B5DF37
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 623
- Molecular Weight:
- 68kDa
- Application:
- WB
- Subunit:
- 6L
- Immunogen:
- The immunogen for anti-Taf6l antibody: synthetic peptide corresponding to a region of Rat
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Taf6l antibody - middle region (ARP31490_P050)
- Predicted Homology Based on Immunogen Sequence:
- African clawed frog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Dog: 92%; Horse: 92%; Bovine: 84%; Zebrafish: 84%
- Datasheets / Downloads:
- Printable datasheet for
anti-Taf6l antibody
- ARP31490_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS
- Blocking Peptide:
- For anti-Taf6l antibody is Catalog # AAP31490 (Previous Catalog # AAPP24073)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Taf6l antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
