Eif3d Antibody - N-terminal region (ARP62385_P050)

Catalog No: ARP62385_P050

WB Suggested Anti-Eif3d Antibody
Titration: 1.0 ug/ml
Positive Control: Rat liver

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Eif3d (ARP62385_P050) antibody is Catalog # AAP62385
• Subunit: D

Target Info

• Gene Symbol: Eif3d
• Gene Full Name: Eukaryotic translation initiation factor 3, subunit D
• Alias Symbols: Eif3s7
• NCBI Gene Id: 362952
• Protein Name: Eukaryotic translation initiation factor 3 subunit D
• Description of Target: Eif3d is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.
• Uniprot ID: Q6AYK8
• Protein Accession #: NP_001004283
• Nucleotide Accession #: NM_001004283
• Protein Size (# AA): 548
• Molecular Weight: 60kDa
• Protein Interactions: Sumo3;