RAD54L Antibody - N-terminal region (ARP36355_P050)

Catalog No: ARP36355_P050

WB Suggested Anti-RAD54L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAD54L
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RAD54L (ARP36355_P050) antibody is Catalog # AAP36355 (Previous Catalog # AAPP07691)
• Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Target Info

• Gene Symbol: RAD54L
• Gene Full Name: RAD54-like (S. cerevisiae)
• Alias Symbols: HR54, hHR54, RAD54A, hRAD54
• NCBI Gene Id: 8438
• Protein Name: DNA repair and recombination protein RAD54-like
• Description of Target: This protein belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination.The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q92698
• Protein Accession #: NP_003570
• Nucleotide Accession #: NM_003579
• Protein Size (# AA): 747
• Molecular Weight: 84kDa
• Protein Interactions: WDYHV1; HECW2; UBC; RAD51; E2F4; E2F1;