MYCT1 Antibody - middle region (ARP66407_P050)

Catalog No: ARP66407_P050

WB Suggested Anti-MYCT1 Antibody
Titration: 1.0 ug/ml
Positive Control: ACHN Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MYCT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RRRRASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MYCT1 (ARP66407_P050) antibody is Catalog # AAP66407

Target Info

• Gene Symbol: MYCT1
• Alias Symbols: MTLC
• NCBI Gene Id: 80177
• Protein Name: Myc target protein 1
• Description of Target: MYCT1 may regulate certain MYC target genes, MYC seems to be a direct upstream transcriptional activator. MYCT1 does not seem to significantly affect growth cell capacity. Overexpression seems to mediate many of the known phenotypic features associated with MYC, including promotion of apoptosis, alteration of morphology, enhancement of anchorage-independent growth, tumorigenic conversion, promotion of genomic instability, and inhibition of hematopoietic differentiation.
• Uniprot ID: Q8N699
• Protein Accession #: NP_079383
• Nucleotide Accession #: NM_025107
• Protein Size (# AA): 235
• Molecular Weight: 26kDa