- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
TADA3L Antibody - C-terminal region (ARP38786_P050)
Datasheets/Manuals | Printable datasheet for anti-TADA3 (ARP38786_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TADA3L |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: RVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-TADA3 (ARP38786_P050) antibody is Catalog # AAP38786 (Previous Catalog # AAPP20991) |
Reference | Rual,J.F., (2005) Nature 437 (7062), 1173-1178 |
Gene Symbol | TADA3 |
---|---|
Gene Full Name | Transcriptional adaptor 3 |
Alias Symbols | ADA3, NGG1, hADA3, STAF54, TADA3L |
NCBI Gene Id | 10474 |
Protein Name | Transcriptional adapter 3 |
Description of Target | Adaptor proteins are usually required for transcriptional activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter.TADA3L is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis.Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least four alternatively spliced variants have been found for this gene, but the full-length nature of some variants has not been determined. |
Uniprot ID | O75528 |
Protein Accession # | NP_006345 |
Nucleotide Accession # | NM_006354 |
Protein Size (# AA) | 432 |
Molecular Weight | 49kDa |
Protein Interactions | HEXIM2; CCDC101; CCNC; TP53; USP22; KDM1A; TADA2A; KAT2B; TAF5L; NUP205; SUPT3H; YEATS2; MBIP; WDR5; MAP3K7; DR1; PIAS4; MAGEH1; ING5; XRCC6; SUMO2; SREBF1; TXNRD2; NR1I2; RARA; ESR1; AR; KAT2A; EP300; CTNNB1; ANKRD12; ATXN7; TAF10; FAM107B; ADPGK; HSPA8; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TADA3L Antibody - C-terminal region (ARP38786_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "TADA3L Antibody - C-terminal region (ARP38786_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "TADA3L Antibody - C-terminal region (ARP38786_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TADA3L Antibody - C-terminal region (ARP38786_P050)"?
This target may also be called "ADA3, NGG1, hADA3, STAF54, TADA3L" in publications.
-
What is the shipping cost for "TADA3L Antibody - C-terminal region (ARP38786_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TADA3L Antibody - C-terminal region (ARP38786_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TADA3L Antibody - C-terminal region (ARP38786_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "49kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TADA3L Antibody - C-terminal region (ARP38786_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TADA3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TADA3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TADA3"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TADA3"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TADA3"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TADA3"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.