HSBP1 Antibody - N-terminal region (ARP35643_P050)

Catalog No: ARP35643_P050

WB Suggested Anti-HSBP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Host: Rabbit
Target: HSBP1
Positive control (+): Human Brain (BR)
Negative control (-): Human Fetal Heart (HE)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSBP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: AETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HSBP1 (ARP35643_P050) antibody is Catalog # AAP35643 (Previous Catalog # AAPP07890)
• Reference: Tai,L.J., (2002) J. Biol. Chem. 277 (1), 735-745

Target Info

• Gene Symbol: HSBP1
• Gene Full Name: Heat shock factor binding protein 1
• Alias Symbols: NPC-A-13
• NCBI Gene Id: 3281
• Protein Name: Heat shock factor-binding protein 1
• Description of Target: The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation of HSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor binding protein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. During HS response, HSF1 undergoes conformational transition from an inert non-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cells represses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survival of the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shock response.The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation of HSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor binding protein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. During HS response, HSF1 undergoes conformational transition from an inert non-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cells represses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survival of the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shock response.
• Uniprot ID: O75506
• Protein Accession #: NP_001528
• Nucleotide Accession #: NM_001537
• Protein Size (# AA): 76
• Molecular Weight: 8kDa
• Protein Interactions: NOTCH2NL; KRTAP10-3; KRTAP10-7; LNX1; KIAA1217; CCHCR1; CCDC53; SDCBP; KIFC3; HSBP1; UBC; VCP; RRBP1; RB1CC1; HSF1; HSPA1A; HSPA4;