website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

DFFA antibody - N-terminal region (ARP30359_T100)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Gene Symbol:
DFFA
Official Gene Full Name:
DNA fragmentation factor, 45kDa, alpha polypeptide
NCBI Gene Id:
1676
Alias Symbols:
DFF-45; DFF1; Ion ChannelAD; ICAD
Tissue Tool:
Find tissues and cell lines supported to express DFFA.
Protein Accession #:
NP_004392
Nucleotide Accession#:
NM_004401
Swissprot Id:
O00273
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
DNA fragmentation factor subunit alpha
Protein Size (# AA):
331
Molecular Weight:
37kDa
Application:
WB
Subunit:
alpha
Partner Proteins:
BAK1, BCL6, APEX1, ATF3, ATM, ATM, ATM, ATM, ATR, AURKA, BAK1, BARD1, BAX, BAX, BAX, BCL2L1, BLM, BLM, BLM, BNIP3L, BRCA1, BRCA1, CARM1, CDC25C, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CR2, CREBBP, CUL9, DDX5, DHCR24, EP300, EP300, EP300, ERCC3, ESR1, FOXO3, GPS2, GSK3B, HCVgp1, HCVgp1, HCVgp1, HCVg
Immunogen:
The immunogen for anti-DFFA antibody: synthetic peptide directed towards the N terminal of human DFFA
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
DFFA antibody - N-terminal region (ARP30359_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 83%; Mouse: 83%
Species Reactivity:
Human, Horse, Guinea pig, Bovine, Rat, Dog, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-DFFA antibody
- ARP30359_T100
Peptide Sequence:
Synthetic peptide located within the following region: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDIL
Blocking Peptide:
For anti-DFFA antibody is Catalog # AAP30359 (Previous Catalog # AAPS08806)
Key Reference:
Yan,B., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (5), 1504-1509
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-DFFA antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question