website statistics

Aviva Systems Biology office will be closed for Memorial Day - 5/29/2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DFFA antibody - N-terminal region (ARP30359_T100)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30359_T100-FITC Conjugated

ARP30359_T100-HRP Conjugated

ARP30359_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
DNA fragmentation factor, 45kDa, alpha polypeptide
Protein Name:
DNA fragmentation factor subunit alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DFF-45, DFF1, Ion ChannelAD, ICAD
Replacement Item:
This antibody may replace item sc-17816 from Santa Cruz Biotechnology.
Description of Target:
Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DFFA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DFFA.
The immunogen is a synthetic peptide directed towards the N terminal region of human DFFA
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 83%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 83%; Rat: 92%
Complete computational species homology data:
Anti-DFFA (ARP30359_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDIL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DFFA (ARP30359_T100) antibody is Catalog # AAP30359 (Previous Catalog # AAPS08806)
Datasheets / Downloads:
Printable datasheet for anti-DFFA (ARP30359_T100) antibody
Target Reference:
Yan,B., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (5), 1504-1509

Product Protocols: DFFA antibody tested with Human Jurkat Cells (ARP30359_T100)

Aviva Systems Biology is the original manufacturer of this DFFA antibody (ARP30359_T100)

Click here to view the DFFA antibody Western Blot Protocol

Product Datasheet Link: DFFA antibody (ARP30359_T100)

WB Suggested Anti-DFFA Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:

Description of Target: Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s DFFA antibody (ARP30359_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...