Catalog No: AEP10003
Size:100ug
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PPIA (AEP10003) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Lyophilized powder |
Application | WB |
Reconstitution and Storage | Reconstitute with distilled water. For longer periods of storage, store at -20C. Avoid repeat freeze and thaw cycles. |
Protein Sequence | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Tag | GST |
Gene Symbol | PPIA |
---|---|
Alias Symbols | CYPA, CYPH, HEL-S-69p |
NCBI Gene Id | 5478 |
Protein Name | Peptidyl-prolyl cis-trans isomerase A |
Description of Target | This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. |
Uniprot ID | P62937 |
Protein Accession # | NP_066953 |
Nucleotide Accession # | NM_021130 |
Protein Size (# AA) | 165 |
Molecular Weight | 18kDa |
Protein Interactions | LNX1; HUWE1; UBC; TCF4; FUS; gag; MDM2; RPL23A; SRPK2; SRPK1; ESR1; UBD; TERT; RAD52; VCAM1; ITGA4; FN1; HCVgp1; LIG4; PAXIP1; RB1; APP; CPLX1; SNX3; TAGLN2; SOD1; RPA2; RAD23B; PTMA; IGBP1; ENO1; AKT1; USP4; CDK2; COPS5; CUL1; CUL3; CUL4B; NEDD8; CD99; C |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!