POP7 Antibody - N-terminal region (ARP75341_P050)

Catalog No: ARP75341_P050

Host: Rabbit
Target Name: POP7
Sample Type: Hela Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human POP7
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARC
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP75341
• Reference: N/A

Target Info

• Gene Symbol: POP7
• Alias Symbols: RPP2, RPP20, 0610037N12Rik
• NCBI Gene Id: 10248
• Description of Target: POP7 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.
• Uniprot ID: O75817
• Protein Accession #: NP_005828
• Protein Size (# AA): 140
• Molecular Weight: 15kDa
• Protein Interactions: RPP25L; POP1; UBE2O; POLA2; COPS6; SART3; CUL4B; VASP; EPB41L1; UBC; RPP40; APP; CUL2; RPP25; RPP38; POP7; HSPB1; SMN2; RPP30; RPPH1; RMRP; SMN1;