- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-POLR2H (ARP48697_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human POLR2H |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-POLR2H (ARP48697_T100) antibody is Catalog # AAP48697 (Previous Catalog # AAPP28747) |
Sample Type Confirmation | POLR2H is supported by BioGPS gene expression data to be expressed in HepG2 |
Subunit | RPABC3 |
Reference | Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007) |
Gene Symbol | POLR2H |
---|---|
Gene Full Name | Polymerase (RNA) II (DNA directed) polypeptide H |
Alias Symbols | RPB8, RPB17, RPABC3 |
NCBI Gene Id | 5437 |
Protein Name | DNA-directed RNA polymerases I, II, and III subunit RPABC3 |
Description of Target | POLR2H is one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants have been reported for this gene, but it has not been clearly demonstrated that they encode valid isoforms. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-400 AU142999.1 1-400 401-907 BI772069.1 287-793 908-1792 BC008348.1 928-1812 1793-3185 AC099344.4 111461-112853 c |
Uniprot ID | P52434 |
Protein Accession # | NP_006223 |
Nucleotide Accession # | NM_006232 |
Protein Size (# AA) | 150 |
Molecular Weight | 17kDa |
Protein Interactions | TCEB3; SRC; PSMB9; ESR1; CEP57; RNF2; SNRNP200; SART3; POLR2E; DNMT3B; DNMT3A; BAG3; POLR2C; MED19; METTL18; MED26; UBC; POLR3D; POLR3H; POLR3B; POLR1A; POLR3A; POLR1C; NEDD8; Atf7ip; SUMO2; INTS10; POLR2D; POLR2A; BRCA1; BARD1; INTS5; INTS3; INTS6; INTS1 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "POLR2H Antibody - N-terminal region (ARP48697_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "POLR2H Antibody - N-terminal region (ARP48697_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "POLR2H Antibody - N-terminal region (ARP48697_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "POLR2H Antibody - N-terminal region (ARP48697_T100)"?
This target may also be called "RPB8, RPB17, RPABC3" in publications.
-
What is the shipping cost for "POLR2H Antibody - N-terminal region (ARP48697_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "POLR2H Antibody - N-terminal region (ARP48697_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "POLR2H Antibody - N-terminal region (ARP48697_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "17kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "POLR2H Antibody - N-terminal region (ARP48697_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "POLR2H"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "POLR2H"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "POLR2H"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "POLR2H"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "POLR2H"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "POLR2H"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.