SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP39112_P050
Price: $0.00
SKU
ARP39112_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NT5C (ARP39112_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: QEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
Concentration0.5 mg/ml
Blocking PeptideFor anti-NT5C (ARP39112_P050) antibody is Catalog # AAP39112
Sample Type Confirmation

NT5C is supported by BioGPS gene expression data to be expressed in 721_B

Gene SymbolNT5C
Gene Full Name5', 3'-nucleotidase, cytosolic
Alias SymbolsDNT, cdN, DNT1, P5N2, PN-I, HEL74, PN-II, UMPH2, dNT-1
NCBI Gene Id30833
Protein Name5'(3')-deoxyribonucleotidase, cytosolic type
Description of TargetThis gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene.
Uniprot IDQ8TCD5
Protein Accession #NP_055410
Nucleotide Accession #NM_014595
Protein Size (# AA)201
Molecular Weight23kDa
Protein InteractionsUBC; NT5C;
  1. What is the species homology for "NT5C Antibody - C-terminal region (ARP39112_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "NT5C Antibody - C-terminal region (ARP39112_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NT5C Antibody - C-terminal region (ARP39112_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NT5C Antibody - C-terminal region (ARP39112_P050)"?

    This target may also be called "DNT, cdN, DNT1, P5N2, PN-I, HEL74, PN-II, UMPH2, dNT-1" in publications.

  5. What is the shipping cost for "NT5C Antibody - C-terminal region (ARP39112_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NT5C Antibody - C-terminal region (ARP39112_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NT5C Antibody - C-terminal region (ARP39112_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "23kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NT5C Antibody - C-terminal region (ARP39112_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NT5C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NT5C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NT5C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NT5C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NT5C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NT5C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NT5C Antibody - C-terminal region (ARP39112_P050)
Your Rating