SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP49557_P050
Price: $0.00
SKU
ARP49557_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NLGN4X (ARP49557_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NLGN4X
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE
Concentration0.5 mg/ml
Blocking PeptideFor anti-NLGN4X (ARP49557_P050) antibody is Catalog # AAP49557 (Previous Catalog # AAPP29410)
ReferenceWermter,A.K., Am. J. Med. Genet. B Neuropsychiatr. Genet. 147B (4), 535-537
Gene SymbolNLGN4X
Gene Full NameNeuroligin 4, X-linked
Alias SymbolsHLNX, HNL4X, NLGN4, ASPGX2, AUTSX2
NCBI Gene Id57502
Protein NameNeuroligin-4, Y-linked
Description of TargetNLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene.
Uniprot IDQ8NFZ3
Protein Accession #NP_065793
Nucleotide Accession #NM_020742
Protein Size (# AA)816
Molecular Weight92kDa
Protein InteractionsDLGAP2; DLG4;
  1. What is the species homology for "NLGN4X Antibody - middle region (ARP49557_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "NLGN4X Antibody - middle region (ARP49557_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NLGN4X Antibody - middle region (ARP49557_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NLGN4X Antibody - middle region (ARP49557_P050)"?

    This target may also be called "HLNX, HNL4X, NLGN4, ASPGX2, AUTSX2" in publications.

  5. What is the shipping cost for "NLGN4X Antibody - middle region (ARP49557_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NLGN4X Antibody - middle region (ARP49557_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NLGN4X Antibody - middle region (ARP49557_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "92kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NLGN4X Antibody - middle region (ARP49557_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NLGN4X"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NLGN4X"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NLGN4X"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NLGN4X"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NLGN4X"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NLGN4X"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NLGN4X Antibody - middle region (ARP49557_P050)
Your Rating
We found other products you might like!