website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

NDUFS1 antibody - middle region (ARP56609_P050)

Description of Target:
The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.
Gene Symbol:
NDUFS1
Official Gene Full Name:
NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)
NCBI Gene Id:
4719
Alias Symbols:
CI-75Kd; MGC26839; PRO1304; CI-75k
Tissue Tool:
Find tissues and cell lines supported to express NDUFS1.
Protein Accession #:
NP_004997
Nucleotide Accession#:
NM_005006
Swissprot Id:
P28331
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Protein Size (# AA):
727
Molecular Weight:
77kDa
Application:
WB
Subunit:
mitochondrial
Partner Proteins:
CASP3, MDH2, CASP3, TNFAIP3
Immunogen:
The immunogen for anti-NDUFS1 antibody: synthetic peptide directed towards the middle region of human NDUFS1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
NDUFS1 antibody - middle region (ARP56609_P050)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Zebrafish: 79%
Species Reactivity:
Human, Horse, Goat, Rabbit, Rat, Bovine, Mouse, Dog, Pig, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-NDUFS1 antibody
- ARP56609_P050
Peptide Sequence:
Synthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
Blocking Peptide:
For anti-NDUFS1 antibody is Catalog # AAP56609 (Previous Catalog # AAPP39316)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-NDUFS1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question