SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62873_P050
Price: $0.00
SKU
ARP62873_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MRPS18B (ARP62873_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: SVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTC
Concentration0.5 mg/ml
Blocking PeptideFor anti-MRPS18B (ARP62873_P050) antibody is Catalog # AAP62873
Gene SymbolMRPS18B
Gene Full NameMitochondrial ribosomal protein S18B
Alias SymbolsPTD017, S18amt, C6orf14, HSPC183, MRPS18-2, HumanS18a, MRP-S18-2
NCBI Gene Id28973
Protein Name28S ribosomal protein S18b, mitochondrial
Description of TargetMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins.
Uniprot IDQ9Y676
Protein Accession #NP_054765
Nucleotide Accession #NM_014046
Protein Size (# AA)258
Molecular Weight28kDa
Protein InteractionsTUBGCP4; CEP250; TUBGCP3; VCP; TP53; NEDD1; UBC; PARK2; EXOSC6; EWSR1; mug82; ICT1; EBNA3B; RB1; MRPS9; MRPS26; MRPS25; MRPS35; MRPS22; UBR5; MRPS28; QARS; MYH9; KARS; HNRNPAB; FUS; CAND1; CUL3; Ybx1; NFKBIL1;
  1. What is the species homology for "MRPS18B Antibody - N-terminal region (ARP62873_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "MRPS18B Antibody - N-terminal region (ARP62873_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MRPS18B Antibody - N-terminal region (ARP62873_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MRPS18B Antibody - N-terminal region (ARP62873_P050)"?

    This target may also be called "PTD017, S18amt, C6orf14, HSPC183, MRPS18-2, HumanS18a, MRP-S18-2" in publications.

  5. What is the shipping cost for "MRPS18B Antibody - N-terminal region (ARP62873_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MRPS18B Antibody - N-terminal region (ARP62873_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MRPS18B Antibody - N-terminal region (ARP62873_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MRPS18B Antibody - N-terminal region (ARP62873_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MRPS18B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MRPS18B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MRPS18B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MRPS18B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MRPS18B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MRPS18B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MRPS18B Antibody - N-terminal region (ARP62873_P050)
Your Rating