MPP5 Antibody - N-terminal region (ARP42915_P050)

Catalog No: ARP42915_P050

WB Suggested Anti-MPP5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: MPP5
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: MPP5
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: MPP5
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: MPP5
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MPP5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%
• Peptide Sequence: Synthetic peptide located within the following region: AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MPP5 (ARP42915_P050) antibody is Catalog # AAP42915 (Previous Catalog # AAPP11138)
• Reference: Gosens,I., (2007) Exp. Cell Res. 313 (19), 3959-3970

Target Info

• Gene Symbol: MPP5
• Gene Full Name: Membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
• Alias Symbols: MPP5
• NCBI Gene Id: 64398
• Protein Name: MAGUK p55 subfamily member 5
• Description of Target: Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like, based on their size and the presence of additional domains. MPP5 is a member of the p55-like MAGUK subfamily.Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains (Tseng et al., 2001 [PubMed 11311936]). MPP5 is a member of the p55-like MAGUK subfamily.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q8N3R9
• Protein Accession #: NP_071919
• Nucleotide Accession #: NM_022474
• Protein Size (# AA): 675
• Molecular Weight: 77kDa
• Protein Interactions: LIN7A; WWOX; AMOT; AMOTL2; LATS2; YAP1; LATS1; Wwtr1; ZNF451; UBD; ARHGAP17; UBC; PARD6B; CRB3; MPP4; INADL; ARF6; PARD6A;