HLA-DPA1 Antibody - middle region (ARP50199_P050)

Catalog No: ARP50199_P050

WB Suggested Anti-HLA-DPA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLA-DPA1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 86%
• Peptide Sequence: Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HLA-DPA1 (ARP50199_P050) antibody is Catalog # AAP50199 (Previous Catalog # AAPP29652)
• Reference: Lee,S.J., (2007) Blood 110 (13), 4576-4583

Target Info

• Gene Symbol: HLA-DPA1
• Gene Full Name: Major histocompatibility complex, class II, DP alpha 1
• Alias Symbols: DPA1, PLT1, HLADP, HLASB, DP(W3), DP(W4), HLA-DPA, HLA-DP1A, HLA-DPB1
• NCBI Gene Id: 3113
• Protein Name: HLA class II histocompatibility antigen, DP alpha 1 chain
• Description of Target: The specific function of this protein remains unknown.HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P20036
• Protein Accession #: NP_291032
• Nucleotide Accession #: NM_033554
• Protein Size (# AA): 260
• Molecular Weight: 26kDa
• Protein Interactions: UBC; CD4; HLA-DPB1; CD74;