GALR1 Antibody - C-terminal region (ARP63562_P050)

Catalog No: ARP63562_P050

WB Suggested Anti-GALR1 Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole CellGALR1 is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRID
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GALR1 (ARP63562_P050) antibody is Catalog # AAP63562
• Sample Type Confirmation:

  GALR1 is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: GALR1
• Gene Full Name: Galanin receptor 1
• Alias Symbols: GALNR, GALNR1
• NCBI Gene Id: 2587
• Protein Name: Galanin receptor type 1
• Description of Target: The neuropeptide galanin elicits a range of biological effects by interaction with specific G-protein-coupled receptors. Galanin receptors are seven-transmembrane proteins shown to activate a variety of intracellular second-messenger pathways. GALR1 inhibits adenylyl cyclase via a G protein of the Gi/Go family. GALR1 is widely expressed in the brain and spinal cord, as well as in peripheral sites such as the small intestine and heart.
• Uniprot ID: P47211
• Protein Accession #: NP_001471
• Nucleotide Accession #: NM_001480
• Protein Size (# AA): 349
• Molecular Weight: 38kDa
• Protein Interactions: GAL;