website statistics
Account Login 

Aviva Systems Biology office will be closed for Good Friday - 4/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

FBXO28 antibody - middle region (ARP55192_P050)

Description of Target:
Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Gene Symbol:
Official Gene Full Name:
F-box protein 28
NCBI Gene Id:
Alias Symbols:
FLJ10766; Fbx28; KIAA0483; CENP-30
Tissue Tool:
Find tissues and cell lines supported to express FBXO28.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
F-box only protein 28
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-FBXO28 antibody: synthetic peptide directed towards the middle region of human FBXO28
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
FBXO28 antibody - middle region (ARP55192_P050)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%
Species Reactivity:
Rat, Mouse, Human, Horse, Rabbit, Pig, Dog, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-FBXO28 antibody
- ARP55192_P050
Peptide Sequence:
Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
Blocking Peptide:
For anti-FBXO28 antibody is Catalog # AAP55192 (Previous Catalog # AAPP33019)
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for FBXO28 antibody (ARP55192)

Product page for FBXO28 antibody (ARP55192)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant FBXO28 antibody; Loxodonta africana FBXO28 antibody G3SM28 100%
Bovine FBX28 antibody; Bos taurus FBX28 antibody Q2NL16 92%
Dog FBXO28 antibody; Canis familiaris FBXO28 antibody E2QVB7 92%
Duckbill platypus 100081625 antibody; Ornithorhynchus anatinus 100081625 antibody F7F9F7 92%
Duckbill platypus 100081625 antibody; Ornithorhynchus anatinus 100081625 antibody F7F9F3 92%
Duckbill platypus LOC100091693 antibody; Ornithorhynchus anatinus LOC100091693 antibody F7D468 92%
Gray short-tailed opossum FBXO28 antibody; Monodelphis domestica FBXO28 antibody F7EQN9 92%
Guinea pig LOC100735209 antibody; Cavia porcellus LOC100735209 antibody H0VL89 85%
Horse FBXO28 antibody; Equus caballus FBXO28 antibody F6WFN5 92%
Human FBX28 antibody; Homo sapiens FBX28 antibody Q9NVF7 100%
Little brown bat FBXO28 antibody; Myotis lucifugus FBXO28 antibody G1PVD7 92%
Lowland gorilla FBXO28 antibody; Gorilla gorilla gorilla FBXO28 antibody G3RP65 100%
Lowland gorilla FBXO28 antibody; Gorilla gorilla gorilla FBXO28 antibody G3R5V8 100%
Mouse FBX28 antibody; Mus musculus FBX28 antibody Q8BIG4 100%
Mouse Fbxo28 antibody; Mus musculus Fbxo28 antibody Q66L41 100%
Northern white-cheeked gibbon FBXO28 antibody; Nomascus leucogenys FBXO28 antibody G1RSM9 100%
Pig LOC100520046 antibody; Sus scrofa LOC100520046 antibody F1S641 92%
Rabbit LOC100348256 antibody; Oryctolagus cuniculus LOC100348256 antibody G1SKW6 92%
Rat Fbxo28 antibody; Rattus norvegicus Fbxo28 antibody B2RZ28 100%
Rhesus macaque FBXO28 antibody; Macaca mulatta FBXO28 antibody F6Z0J2 100%
Small-eared galago FBXO28 antibody; Otolemur garnettii FBXO28 antibody H0XVL0 100%
Tasmanian devil FBXO28 antibody; Sarcophilus harrisii FBXO28 antibody G3VDY2 92%
White-tufted-ear marmoset LOC100404495 antibody; Callithrix jacchus LOC100404495 antibody F7GIB0 85%

Product Protocols: FBXO28 antibody tested with Human Mcf7 Cells (ARP55192_P050)

Aviva Systems Biology is the original manufacturer of this FBXO28 antibody (ARP55192_P050)

Click here to view the FBXO28 antibody Western Blot Protocol

Product Datasheet Link: FBXO28 antibody (ARP55192_P050)

WB Suggested Anti-FBXO28 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7

Western Blot image:

Description of Target: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FBXO28 antibody (ARP55192_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question