website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

FBXO28 antibody - middle region (ARP55192_P050)

Description of Target:
Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Gene Symbol:
FBXO28
Official Gene Full Name:
F-box protein 28
NCBI Gene Id:
23219
Alias Symbols:
FLJ10766; Fbx28; KIAA0483; CENP-30
Tissue Tool:
Find tissues and cell lines supported to express FBXO28.
Protein Accession #:
NP_055991
Nucleotide Accession#:
NM_015176
Swissprot Id:
Q9NVF7
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
F-box only protein 28
Protein Size (# AA):
368
Molecular Weight:
41kDa
Application:
WB
Partner Proteins:
UPF1
Immunogen:
The immunogen for anti-FBXO28 antibody: synthetic peptide directed towards the middle region of human FBXO28
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
FBXO28 antibody - middle region (ARP55192_P050)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%
Species Reactivity:
Rat, Mouse, Human, Horse, Rabbit, Pig, Dog, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-FBXO28 antibody
- ARP55192_P050
Peptide Sequence:
Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
Blocking Peptide:
For anti-FBXO28 antibody is Catalog # AAP55192 (Previous Catalog # AAPP33019)
Key Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-FBXO28 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question