FBXO28 antibody - middle region (ARP55192_P050)

Catalog#: ARP55192_P050

• Size: 50ug

Human MCF-7

• Description of Target: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
• Gene Symbol: FBXO28
• Official Gene Full Name: F-box protein 28
• Alias Symbols: FLJ10766; Fbx28; KIAA0483; CENP-30
• Protein Accession#: NP_055991
• Nucleotide Accession#: NM_015176
• Swissprot Id: Q9NVF7
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 368
• Molecular Weight: 41kDa
• Application: WB
• Partner Proteins: UPF1
• Immunogen: The immunogen for anti-FBXO28 antibody: synthetic peptide directed towards the middle region of human FBXO28
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Mouse: 100%; Rat: 100%; Dog: 92%; Horse: 92%
• Peptide Sequence: Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
• Blocking Peptide: For anti-FBXO28 antibody is Catalog # AAP55192 (Previous Catalog # AAPP33019)
• Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-FBXO28 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: FBXO28 antibody tested with Human Mcf7 Cells (ARP55192_P050)

Aviva Systems Biology is the original manufacturer of this FBXO28 antibody (ARP55192_P050)

Click here to view the FBXO28 antibody Western Blot Protocol

Product Datasheet Link: FBXO28 antibody (ARP55192_P050)

WB Suggested Anti-FBXO28 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7

Western Blot image:


Description of Target: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s FBXO28 antibody (ARP55192_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com