website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

FBXO28 antibody - middle region (ARP55192_P050)

Description of Target:
Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Gene Symbol:
FBXO28
Official Gene Full Name:
F-box protein 28
NCBI Gene Id:
23219
Alias Symbols:
FLJ10766; Fbx28; KIAA0483; CENP-30
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBXO28.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBXO28.
Swissprot Id:
Q9NVF7
Protein Accession #:
NP_055991
Nucleotide Accession #:
NM_015176
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
F-box only protein 28
Protein Size (# AA):
368
Molecular Weight:
41kDa
Application:
WB
Protein Interactions:
PLEKHF2; SDCBP2; SPAG5; SKP1; GOLGA2; PAK1; LYN; HSP90AA1; GK; UBC; PSMB1; Cep55; TRAF2;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FBXO28
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-FBXO28 (ARP55192_P050)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%
Species Reactivity:
Rat, Mouse, Human, Horse, Rabbit, Pig, Dog, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for anti-FBXO28 (ARP55192_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
Blocking Peptide:
For anti-FBXO28 (ARP55192_P050) antibody is Catalog # AAP55192 (Previous Catalog # AAPP33019)
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: FBXO28 antibody tested with Human Mcf7 Cells (ARP55192_P050)

Aviva Systems Biology is the original manufacturer of this FBXO28 antibody (ARP55192_P050)

Click here to view the FBXO28 antibody Western Blot Protocol

Product Datasheet Link: FBXO28 antibody (ARP55192_P050)

WB Suggested Anti-FBXO28 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7

Western Blot image:


Description of Target: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s FBXO28 antibody (ARP55192_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question