website statistics

Aviva Systems Biology office will be closed for Memorial Day - 5/29/2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FBXO28 antibody - middle region (ARP55192_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP55192_P050-FITC Conjugated

ARP55192_P050-HRP Conjugated

ARP55192_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
F-box protein 28
Protein Name:
F-box only protein 28
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ10766, Fbx28, KIAA0483, CENP-30
Replacement Item:
This antibody may replace item sc-376851 from Santa Cruz Biotechnology.
Description of Target:
Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBXO28.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBXO28.
The immunogen is a synthetic peptide directed towards the middle region of human FBXO28
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-FBXO28 (ARP55192_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FBXO28 (ARP55192_P050) antibody is Catalog # AAP55192 (Previous Catalog # AAPP33019)
Datasheets / Downloads:
Printable datasheet for anti-FBXO28 (ARP55192_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Protocols: FBXO28 antibody tested with Human Mcf7 Cells (ARP55192_P050)

Aviva Systems Biology is the original manufacturer of this FBXO28 antibody (ARP55192_P050)

Click here to view the FBXO28 antibody Western Blot Protocol

Product Datasheet Link: FBXO28 antibody (ARP55192_P050)

WB Suggested Anti-FBXO28 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7

Western Blot image:

Description of Target: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FBXO28 antibody (ARP55192_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...