SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP49633_P050
Price: $0.00
SKU
ARP49633_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

BAT5 Antibody - middle region (ARP49633_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ABHD16A (ARP49633_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human BAT5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL
Concentration0.5 mg/ml
Blocking PeptideFor anti-ABHD16A (ARP49633_P050) antibody is Catalog # AAP49633 (Previous Catalog # AAPP29479)
ReferenceWan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729
Gene SymbolABHD16A
Gene Full NameAbhydrolase domain containing 16A
Alias SymbolsBAT5, NG26, PP199, hBAT5, D6S82E
NCBI Gene Id7920
Protein NameAbhydrolase domain-containing protein 16A
Description of TargetA cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity.
Uniprot IDO95870
Protein Accession #NP_066983
Nucleotide Accession #NM_021160
Protein Size (# AA)558
Molecular Weight63kDa
Protein InteractionsFAM134C; DTX2; RNF5; UPF1; UBC; MLH1; RICTOR; TMEM147; GPRC5C; TMEM222; SPAG7; DNAJC1; ND4; ND3; PILRB; HM13; IFITM1; SAFB; ATP5G3; PTGS2; HNRNPA1;
  1. What is the species homology for "BAT5 Antibody - middle region (ARP49633_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "BAT5 Antibody - middle region (ARP49633_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BAT5 Antibody - middle region (ARP49633_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BAT5 Antibody - middle region (ARP49633_P050)"?

    This target may also be called "BAT5, NG26, PP199, hBAT5, D6S82E" in publications.

  5. What is the shipping cost for "BAT5 Antibody - middle region (ARP49633_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BAT5 Antibody - middle region (ARP49633_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BAT5 Antibody - middle region (ARP49633_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BAT5 Antibody - middle region (ARP49633_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ABHD16A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ABHD16A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ABHD16A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ABHD16A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ABHD16A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ABHD16A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BAT5 Antibody - middle region (ARP49633_P050)
Your Rating
We found other products you might like!