Catalog No: ARP42365_P050
Price: $0.00
SKU
ARP42365_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ATP6V0A2 (ARP42365_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Human Kidney (formalin-fixed, paraffin-embedded) stained with ATP6V0A2 antibody ARP42365_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Kidney (formalin-fixed, paraffin-embedded) stained with ATP6V0A2 antibody ARP42365_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V0A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%; Yeast: 79%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATP6V0A2 (ARP42365_P050) antibody is Catalog # AAP42365 (Previous Catalog # AAPP11553)
Subunita isoform 2
Other Applications Image 1 DataIHC Suggested Anti-ATP6V0A2 antibody
Titration: 4 ug/ml
Positive Control: HeLa cells
ReferenceKornak,U., (2008) Nat. Genet. 40 (1), 32-34
Gene SymbolATP6V0A2
Gene Full NameATPase, H+ transporting, lysosomal V0 subunit a2
Alias SymbolsA2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ6S, VPH1, ARCL2A, ATP6A2, ATP6N1D
NCBI Gene Id23545
Protein NameV-type proton ATPase 116 kDa subunit a isoform 2
Description of TargetThe multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain.The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain (Smith et al., 2003 [PubMed 14580332]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ9Y487
Protein Accession #NP_036595
Nucleotide Accession #NM_012463
Protein Size (# AA)856
Molecular Weight98kDa
Protein InteractionsUBC; RPL10L; PTRH2; ATP6V1D; RPS15; RPS2; SLC25A3; AKT1; ELAVL1; CYTH2;
  1. What is the species homology for "ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Yeast, Zebrafish".

  2. How long will it take to receive "ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)"?

    This target may also be called "A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ6S, VPH1, ARCL2A, ATP6A2, ATP6N1D" in publications.

  5. What is the shipping cost for "ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "98kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP6V0A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP6V0A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP6V0A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP6V0A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP6V0A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP6V0A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP6V0A2 Antibody - N-terminal region (ARP42365_P050)
Your Rating
We found other products you might like!