RCHY1 Antibody - middle region (ARP87665_P050)

• Product Number: ARP87665_P050
• Name: RCHY1 Antibody - middle region (ARP87665_P050)
• Protein Size (# AA): 261 amino acids
• Molecular Weight: 28 kDa
• NCBI Gene Id: 25898
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ring finger and CHY zinc finger domain containing 1
• Alias Symbols: ZCHY, ARNIP, CHIMP, PIRH2, RNF199, ZNF363, PRO1996
• Peptide Sequence: Synthetic peptide located within the following region: CRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCDI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RCHY1 (ARP87665_P050) antibody is Catalog # AAP87665
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RCHY1
• Uniprot ID: Q96PM5
• Protein Name: RING finger and CHY zinc finger domain-containing protein 1
• Protein Accession #: NP_001009922.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001009922.2
• Tested Species Reactivity: Human
• Gene Symbol: RCHY1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: RCHY1
  Sample Tissue: Human HT1080 Whole Cell lysates
  Antibody Dilution: 1ug/ml