Search Antibody, Protein, and ELISA Kit Solutions

RCHY1 Antibody - middle region (ARP87665_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
RCHY1
Official Gene Full Name:
ring finger and CHY zinc finger domain containing 1
NCBI Gene Id:
25898
Protein Name:
RING finger and CHY zinc finger domain-containing protein 1
Swissprot Id:
Q96PM5
Protein Accession #:
NP_001009922.1
Nucleotide Accession #:
NM_001009922.2
Alias Symbols:
ZCHY, ARNIP, CHIMP, PIRH2, RNF199, ZNF363, PRO1996
Description of Target:
The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
261
Molecular Weight:
28 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RCHY1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RCHY1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RCHY1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: CRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCDI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RCHY1 (ARP87665_P050) antibody is Catalog # AAP87665
Datasheets/Manuals:
Printable datasheet for anti-RCHY1 (ARP87665_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...