| Sku |
AAP87665 |
| Price |
99 |
| Name |
RCHY1 Peptide - middle region (AAP87665) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
RCHY1 |
| Alias symbols |
ZCHY, ARNIP, CHIMP, PIRH2, RNF199, ZNF363, PRO1996 |
| Gene id |
25898 |
| Description of target |
The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Swissprot id |
Q96PM5 |
| Protein accession num |
NP_001009922.1 |
| Nucleotide accession num |
NM_001009922.2 |
| Protein size |
261 amino acids |
| Molecular weight |
28 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: CRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCDI |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- RCHY1 Antibody (ARP87665_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
