PDX1 Antibody - middle region (ARP87020_P050)

• Product Number: ARP87020_P050
• Name: PDX1 Antibody - middle region (ARP87020_P050)
• Protein Size (# AA): 283 amino acids
• Molecular Weight: 31 kDa
• NCBI Gene Id: 3651
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: pancreatic and duodenal homeobox 1
• Alias Symbols: GSF, IPF1, IUF1, IDX-1, MODY4, PDX-1, STF-1, PAGEN1
• Peptide Sequence: Synthetic peptide located within the following region: KEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PDX1 (ARP87020_P050) antibody is Catalog # AAP87020
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDX1
• Uniprot ID: P52945
• Protein Name: Pancreas/duodenum homeobox protein 1
• Protein Accession #: NP_000200.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_000209.3
• Tested Species Reactivity: Human
• Gene Symbol: PDX1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human HepG2 Whole Cell
  
  Host: Rabbit
  Target Name: PDX1
  Sample Tissue: Human HepG2 Whole Cell lysates
  Antibody Dilution: 1ug/ml