Search Antibody, Protein, and ELISA Kit Solutions

PDX1 Antibody - middle region (ARP87020_P050)

100 ul
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
pancreatic and duodenal homeobox 1
NCBI Gene Id:
Protein Name:
Pancreas/duodenum homeobox protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).
Protein Size (# AA):
Molecular Weight:
31 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDX1.
The immunogen is a synthetic peptide directed towards the middle region of human PDX1
Peptide Sequence:
Synthetic peptide located within the following region: KEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PDX1 (ARP87020_P050) antibody is Catalog # AAP87020
Printable datasheet for anti-PDX1 (ARP87020_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...