FAM19A2 Antibody - middle region (ARP80297_P050)

• Product Number: ARP80297_P050
• Name: FAM19A2 Antibody - middle region (ARP80297_P050)
• Protein Size (# AA): 131 amino acids
• Molecular Weight: 14 kDa
• NCBI Gene Id: 338811
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: family with sequence similarity 19 (chemokine (C-C motif)-like), member A2
• Alias Symbols: TAFA-2, FAM19A2
• Peptide Sequence: Synthetic peptide located within the following region: QKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FAM19A2 (ARP80297_P050) antibody is Catalog # AAP80297
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM19A2
• Uniprot ID: Q8N3H0
• Protein Name: protein FAM19A2
• Protein Accession #: NP_848634.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_178539.4
• Tested Species Reactivity: Human
• Gene Symbol: FAM19A2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human 786-0 Whole Cell
  
  Host: Rabbit
  Target Name: FAM19A2
  Sample Tissue: Human 786-0 Whole Cell lysates
  Antibody Dilution: 1ug/ml