Search Antibody, Protein, and ELISA Kit Solutions

FAM19A2 Antibody - middle region (ARP80297_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FAM19A2
Purification:
Affinity purified
Peptide Sequence:
Synthetic peptide located within the following region: QKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FAM19A2 (ARP80297_P050) antibody is Catalog # AAP80297
Datasheets/Manuals:
Printable datasheet for anti-FAM19A2 (ARP80297_P050) antibody
Gene Symbol:
FAM19A2
Official Gene Full Name:
family with sequence similarity 19 (chemokine (C-C motif)-like), member A2
Alias Symbols:
TAFA2, TAFA-2
NCBI Gene Id:
338811
Protein Name:
protein FAM19A2
Description of Target:
This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.
Swissprot Id:
Q8N3H0
Protein Accession #:
NP_848634.1
Nucleotide Accession #:
NM_178539.4
Protein Size (# AA):
131
Molecular Weight:
14 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FAM19A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FAM19A2.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...