| Sku |
AAP80297 |
| Price |
99 |
| Name |
FAM19A2 Peptide - middle region (AAP80297) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
FAM19A2 |
| Alias symbols |
TAFA2, TAFA-2 |
| Gene id |
338811 |
| Description of target |
This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. |
| Swissprot id |
Q8N3H0 |
| Protein accession num |
NP_848634.1 |
| Nucleotide accession num |
NM_178539.4 |
| Protein size |
131 amino acids |
| Molecular weight |
14 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: QKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKN |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- FAM19A2 Antibody (ARP80297_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
