Product Number |
ARP64265_P050 |
Product Page |
www.avivasysbio.com/spam1-antibody-middle-region-arp64265-p050.html |
Name |
SPAM1 Antibody - middle region (ARP64265_P050) |
Protein Size (# AA) |
509 amino acids |
Molecular Weight |
58 kDa |
NCBI Gene Id |
6677 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15, HEL-S-96n |
Peptide Sequence |
Synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-SPAM1 (ARP64265_P050) antibody |
Blocking Peptide |
For anti-SPAM1 (ARP64265_P050) antibody is Catalog # AAP64265 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SPAM1 |
Uniprot ID |
P38567 |
Protein Accession # |
NP_694859 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
SPAM1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: SPAM1 Sample Type: 786-0 Whole Cell lysates Antibody Dilution: 1.0ug/ml |
| Image 2 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
|