Search Antibody, Protein, and ELISA Kit Solutions

SPAM1 Antibody - middle region (ARP64265_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP64265_P050-FITC Conjugated

ARP64265_P050-HRP Conjugated

ARP64265_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-153709 from Santa Cruz Biotechnology.
Description of Target:
Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SPAM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SPAM1.
The immunogen is a synthetic peptide directed towards the middle region of Human SPAM1
Peptide Sequence:
Synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SPAM1 (ARP64265_P050) antibody is Catalog # AAP64265
Printable datasheet for anti-SPAM1 (ARP64265_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...