NGFR Antibody - C-terminal region (ARP63279_P050)

Data Sheet
 
Product Number ARP63279_P050
Product Page www.avivasysbio.com/ngfr-antibody-c-terminal-region-arp63279-p050.html
Product Name NGFR Antibody - C-terminal region (ARP63279_P050)
Size 100 ul
Gene Symbol NGFR
Alias Symbols CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Protein Size (# AA) 427 amino acids
Molecular Weight 47kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 4804
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Nerve growth factor receptor
Peptide Sequence Synthetic peptide located within the following region: VTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQ
Description of Target Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain.
Protein Interactions TRAF6; IKBKB; SQSTM1; UBC; CD80; BFAR; NGFRAP1; MAGEH1; NGFR; STMN2; UFD1L; TTR; TK1; SMN1; RPN2; H2AFX; RCC1; CDKN1A; ANXA7; PIAS2; SP1; MYCN; TCF19; KIDINS220; RTN4R; LINGO1; NGF; NFKBIB; BEX1; ZNF274; TRADD; RIPK2; TRA2B; FSCN1; TRAF4; SORT1; NDN; TRAF
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-NGFR (ARP63279_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-NGFR (ARP63279_P050) antibody is Catalog # AAP63279
Complete computational species homology data Anti-NGFR (ARP63279_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NGFR.
Swissprot Id P08138
Protein Name Tumor necrosis factor receptor superfamily member 16
Protein Accession # NP_002498
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NGFR.
Nucleotide Accession # NM_002507
Replacement Item This antibody may replace item sc-13577 from Santa Cruz Biotechnology.
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Image 1
Human ACHN
WB Suggested Anti-NGFR Antibody
Titration: 1.0 ug/ml
Positive Control: ACHN Whole Cell
Image 2
Mouse Heart
Host: Mouse
Target Name: NGFR
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com