Search Antibody, Protein, and ELISA Kit Solutions

NGFR Antibody - C-terminal region (ARP63279_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63279_P050-FITC Conjugated

ARP63279_P050-HRP Conjugated

ARP63279_P050-Biotin Conjugated

Gene Symbol:
NGFR
Official Gene Full Name:
Nerve growth factor receptor
NCBI Gene Id:
4804
Protein Name:
Tumor necrosis factor receptor superfamily member 16
Swissprot Id:
P08138
Protein Accession #:
NP_002498
Nucleotide Accession #:
NM_002507
Alias Symbols:
CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Replacement Item:
This antibody may replace item sc-13577 from Santa Cruz Biotechnology.
Description of Target:
Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain.
Protein Size (# AA):
427
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NGFR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NGFR.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-NGFR (ARP63279_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TRAF6; IKBKB; SQSTM1; UBC; CD80; BFAR; NGFRAP1; MAGEH1; NGFR; STMN2; UFD1L; TTR; TK1; SMN1; RPN2; H2AFX; RCC1; CDKN1A; ANXA7; PIAS2; SP1; MYCN; TCF19; KIDINS220; RTN4R; LINGO1; NGF; NFKBIB; BEX1; ZNF274; TRADD; RIPK2; TRA2B; FSCN1; TRAF4; SORT1; NDN; TRAF
Blocking Peptide:
For anti-NGFR (ARP63279_P050) antibody is Catalog # AAP63279
Datasheets/Manuals:
Printable datasheet for anti-NGFR (ARP63279_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...