Sku |
AAP63279 |
Price |
$99.00 |
Name |
NGFR Peptide - C-terminal region (AAP63279) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
NGFR |
Alias symbols |
CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR |
Gene id |
4804 |
Description of target |
Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain. |
Swissprot id |
P08138 |
Protein accession num |
NP_002498 |
Nucleotide accession num |
NM_002507 |
Protein size |
427 amino acids |
Molecular weight |
47kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
VTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQ |
Partner proteins |
LINGO1,NGF,NGF,NTF4,RTN4R,RTN4R,RTN4R,SORT1,TRADD,BEX1,CAV1,FSCN1,GRB2,IL2,KIDINS220,LINGO1,MAG,MAGED1,MAGEH1,MAPK1,MAPK3,NDN,NFKBIB,NGF,NGFRAP1,NTF4,NTRK1,NTRK2,NTRK3,PRKACB,PTPN13,RIPK2,RTN4R,SHC1,SORT1,TRA2B,TRADD,TRAF2,TRAF4,TRAF6,ZNF274,CAV1,FSCN1,MAGED1,MAGEH1,MYCN,NDN,NDNL2,NGF,NGFRAP1,PIAS2,PRKACB,SHC1,SP1,TCF19,TRADD,TRAF1,TRAF2,TRAF3,TRAF4,TRAF5,TRAF6,TRIM37 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-NGFR Antibody (ARP63279_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |