NGFR Peptide - C-terminal region (AAP63279)

Data Sheet
 
Sku AAP63279
Price $99.00
Name NGFR Peptide - C-terminal region (AAP63279)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene symbol NGFR
Alias symbols CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Gene id 4804
Description of target Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain.
Swissprot id P08138
Protein accession num NP_002498
Nucleotide accession num NM_002507
Protein size 427 amino acids
Molecular weight 47kDa
Species reactivity Human
Application WB
Peptide sequence VTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQ
Partner proteins LINGO1,NGF,NGF,NTF4,RTN4R,RTN4R,RTN4R,SORT1,TRADD,BEX1,CAV1,FSCN1,GRB2,IL2,KIDINS220,LINGO1,MAG,MAGED1,MAGEH1,MAPK1,MAPK3,NDN,NFKBIB,NGF,NGFRAP1,NTF4,NTRK1,NTRK2,NTRK3,PRKACB,PTPN13,RIPK2,RTN4R,SHC1,SORT1,TRA2B,TRADD,TRAF2,TRAF4,TRAF6,ZNF274,CAV1,FSCN1,MAGED1,MAGEH1,MYCN,NDN,NDNL2,NGF,NGFRAP1,PIAS2,PRKACB,SHC1,SP1,TCF19,TRADD,TRAF1,TRAF2,TRAF3,TRAF4,TRAF5,TRAF6,TRIM37
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-NGFR Antibody (ARP63279_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com