RECK Antibody - middle region (ARP59229_P050)

• Product Number: ARP59229_P050
• Name: RECK Antibody - middle region (ARP59229_P050)
• Protein Size (# AA): 971 amino acids
• Molecular Weight: 106kDa
• NCBI Gene Id: 8434
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: reversion-inducing-cysteine-rich protein with kazal motifs
• Alias Symbols: ST15
• Peptide Sequence: Synthetic peptide located within the following region: GSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: N/A
• Description of Target: The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RECK (ARP59229_P050) antibody is Catalog # AAP59229
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RECK
• Uniprot ID: O95980
• Protein Name: Reversion-inducing cysteine-rich protein with Kazal motifs
• Protein Accession #: NP_066934
• Purification: Affinity purified
• Tested Species Reactivity: Human
• Gene Symbol: RECK
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Breast Tumor
  
  Host: Rabbit
  Target Name: RECK
  Sample Type: Breast Tumor lysates
  Antibody Dilution: 1.0ug/ml