| Sku |
AAP59229 |
| Price |
99 |
| Name |
RECK Peptide - middle region (AAP59229) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
RECK |
| Alias symbols |
RECK,ST15, |
| Gene id |
8434 |
| Description of target |
The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. |
| Swissprot id |
O95980 |
| Protein accession num |
NP_066934 |
| Protein size |
971 amino acids |
| Molecular weight |
106kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: GSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTY |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti-RECK Antibody (ARP59229_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
