Search Antibody, Protein, and ELISA Kit Solutions

RECK Antibody - middle region (ARP59229_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59229_P050-FITC Conjugated

ARP59229_P050-HRP Conjugated

ARP59229_P050-Biotin Conjugated

Gene Symbol:
RECK
Official Gene Full Name:
reversion-inducing-cysteine-rich protein with kazal motifs
NCBI Gene Id:
8434
Protein Name:
Reversion-inducing cysteine-rich protein with Kazal motifs
Swissprot Id:
O95980
Protein Accession #:
NP_066934
Alias Symbols:
RECK, ST15,
Replacement Item:
This antibody may replace item sc-136270 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis.
Protein Size (# AA):
971
Molecular Weight:
106kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RECK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RECK.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human RECK
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-RECK (ARP59229_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RECK (ARP59229_P050) antibody is Catalog # AAP59229
Datasheets/Manuals:
Printable datasheet for anti-RECK (ARP59229_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...