Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP59229_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59229_P050-FITC Conjugated

ARP59229_P050-HRP Conjugated

ARP59229_P050-Biotin Conjugated

RECK Antibody - middle region (ARP59229_P050)

Catalog#: ARP59229_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-136270 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human RECK
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology dataAnti-RECK (ARP59229_P050)
Peptide SequenceSynthetic peptide located within the following region: GSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-RECK (ARP59229_P050) antibody is Catalog # AAP59229
Datasheets/ManualsPrintable datasheet for anti-RECK (ARP59229_P050) antibody
Target ReferenceN/A
Gene SymbolRECK
Official Gene Full Namereversion-inducing-cysteine-rich protein with kazal motifs
Alias SymbolsRECK, ST15,
NCBI Gene Id8434
Protein NameReversion-inducing cysteine-rich protein with Kazal motifs
Description of TargetThe protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis.
Swissprot IdO95980
Protein Accession #NP_066934
Protein Size (# AA)971
Molecular Weight106kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express RECK.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express RECK.
Write Your Own Review
You're reviewing:RECK Antibody - middle region (ARP59229_P050)
Your Rating
Aviva HIS tag Deal
Aviva Pathways
Assay Development
Aviva Travel Grant