ASAH1 Antibody - N-terminal region (ARP57760_P050)

• Product Number: ARP57760_P050
• Name: ASAH1 Antibody - N-terminal region (ARP57760_P050)
• Protein Size (# AA): 395 amino acids
• Molecular Weight: 45 kDa
• NCBI Gene Id: 427
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: N-acylsphingosine amidohydrolase (acid ceramidase) 1
• Alias Symbols: AC, PHP, ASAH, PHP32, ACDase, SMAPME
• Peptide Sequence: Synthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kim,H.L. (2008) Genetics 178 (3), 1505-1515
• Description of Target: This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into
• Protein Interactions: SRPK1; CAMK1D; FBXO6; UBC; PSMA3; Bub1b; TSC22D1; SETDB1; SMPD1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-ASAH1 (ARP57760_P050) antibody is Catalog # AAP57760 (Previous Catalog # AAPP38817)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASAH1
• Uniprot ID: Q13510
• Protein Name: Acid ceramidase
• Publications:

  Acid ceramidase is upregulated in AML and represents a novel therapeutic target. Oncotarget. 7, 83208-83222 (2016). 27825124

  Quantitative proteomics analysis using 2D-PAGE to investigate the effects of cigarette smoke and aerosol of a prototypic modified risk tobacco product on the lung proteome in C57BL/6 mice. J Proteomics. 145, 237-45 (2016). 27268958

• Protein Accession #: NP_808592
• Purification: Affinity Purified
• Nucleotide Accession #: NM_177924
• Tested Species Reactivity: Human
• Gene Symbol: ASAH1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Human Lung
  
  WB Suggested Anti-ASAH1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Lung
• Image 2:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 14 kDa.