| Product Number |
ARP56507_P050 |
| Product Page |
www.avivasysbio.com/ralb-antibody-middle-region-arp56507-p050.html |
| Name |
Ralb Antibody - middle region (ARP56507_P050) |
| Protein Size (# AA) |
206 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
64143 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) |
| Alias Symbols |
5730472O18Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: EHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPVDEARGK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Ralb is a multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Ralb accomplishes its multiple functions by interacting with distinct downstream effectors. It acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. It is required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Ralb plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. It is required for suppression of apoptosis. |
| Protein Interactions |
Rgl3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ralb (ARP56507_P050) antibody |
| Blocking Peptide |
For anti-Ralb (ARP56507_P050) antibody is Catalog # AAP56507 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Ralb |
| Uniprot ID |
Q9JIW9 |
| Protein Name |
Ras-related protein Ral-B |
| Protein Accession # |
NP_071722 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022327 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Ralb |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Mouse Testis
 | Host: Rabbit
Target Name: Ralb
Sample Type: Mouse Testis lysates
Antibody Dilution: 1.0ug/ml |
|
|
