Ralb Peptide - middle region (AAP56507)

Data Sheet
 
Sku AAP56507
Price $99.00
Name Ralb Peptide - middle region (AAP56507)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Ralb
Alias symbols 5730472O18Rik
Gene id 64143
Description of target Ralb is a multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Ralb accomplishes its multiple functions by interacting with distinct downstream effectors. It acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. It is required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Ralb plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. It is required for suppression of apoptosis.
Swissprot id Q9JIW9
Protein accession num NP_071722
Nucleotide accession num NM_022327
Protein size 206 amino acids
Molecular weight 23kDa
Species reactivity Mouse, Human
Application WB
Peptide sequence EHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPVDEARGK
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Ralb Antibody (ARP56507_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com