Sku |
AAP56507 |
Price |
$99.00 |
Name |
Ralb Peptide - middle region (AAP56507) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
Ralb |
Alias symbols |
5730472O18Rik |
Gene id |
64143 |
Description of target |
Ralb is a multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Ralb accomplishes its multiple functions by interacting with distinct downstream effectors. It acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. It is required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Ralb plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. It is required for suppression of apoptosis. |
Swissprot id |
Q9JIW9 |
Protein accession num |
NP_071722 |
Nucleotide accession num |
NM_022327 |
Protein size |
206 amino acids |
Molecular weight |
23kDa |
Species reactivity |
Mouse, Human |
Application |
WB |
Peptide sequence |
EHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPVDEARGK |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-Ralb Antibody (ARP56507_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |