Search Antibody, Protein, and ELISA Kit Solutions

Ralb Antibody - middle region (ARP56507_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56507_P050-FITC Conjugated

ARP56507_P050-HRP Conjugated

ARP56507_P050-Biotin Conjugated

Gene Symbol:
Ralb
Official Gene Full Name:
v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
NCBI Gene Id:
64143
Protein Name:
Ras-related protein Ral-B
Swissprot Id:
Q9JIW9
Protein Accession #:
NP_071722
Nucleotide Accession #:
NM_022327
Alias Symbols:
5730472O18Rik
Replacement Item:
This antibody may replace item sc-1531 from Santa Cruz Biotechnology.
Description of Target:
Ralb is a multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Ralb accomplishes its multiple functions by interacting with distinct downstream effectors. It acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. It is required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Ralb plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. It is required for suppression of apoptosis.
Protein Size (# AA):
206
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ralb.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ralb.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Mouse Ralb
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide Sequence:
Synthetic peptide located within the following region: EHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPVDEARGK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Rgl3;
Blocking Peptide:
For anti-Ralb (ARP56507_P050) antibody is Catalog # AAP56507
Datasheets/Manuals:
Printable datasheet for anti-Ralb (ARP56507_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...