MBP Antibody - middle region (ARP56224_P050)

• Product Number: ARP56224_P050
• Name: MBP Antibody - middle region (ARP56224_P050)
• Protein Size (# AA): 304 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 4155
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Myelin basic protein
• Alias Symbols: MGC99675
• Peptide Sequence: Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Zhang,Q.Y., (2008) Arch. Med. Res. 39 (1), 45-51
• Description of Target: The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. MBP induces T-cell proliferation.The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.
• Protein Interactions: CTDSP1; MAP3K3; UBC; PRKCB; MAPK3; MAPK1; ULK1; SQSTM1; PKN1; HIPK2; MNAT1; CDK9; CDK8; CDK7; CCNT1; CCNH; CCNC; MELK; DDX58; MAPK14; AT4G38520; AT4G31860; AT4G28400; ABI1; RPS6KA6; TOPP8; AT5G24940; AT5G10740; AT5G06750; AT3G17250; AT3G02750; AT3G15260;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Other Applications Image 1 Data: IP Suggested Anti-MBP Antibody
  Positive Control: NT2 CELL/BRAIN TISSUE
  
• Other Applications Image 2 Data: IP Suggested Anti-MBP antibody
  Titration: 2 ug/ml
  Positive Control: Rat brain homogenate
  
• Blocking Peptide: For anti-MBP (ARP56224_P050) antibody is Catalog # AAP56224 (Previous Catalog # AAPP38142)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MBP
• Uniprot ID: P02686
• Protein Name: Myelin basic protein
• Protein Accession #: NP_001020272
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001025101
• Tested Species Reactivity: Human, Rat
• Gene Symbol: MBP
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, IP, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 80%; Dog: 87%; Guinea Pig: 79%; Horse: 80%; Human: 100%; Mouse: 93%; Pig: 80%; Rabbit: 93%; Rat: 87%
• Image 1: Human brain
  
  WB Suggested Anti-MBP Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human brain
• Image 2: Human brain
  
  Sample Type:
  Human brain stem cells
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat anti-rabbit Alexa-Fluor 594
  Secondary Antibody Dilution:
  1:1000
  Color/Signal Descriptions:
  MBP: Red DAPI:Blue
  Gene Name:
  MBP
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science
• Image 3: Human NT2
  
  IP Suggested Anti-MBP Antibody Positive Control: NT2 CELL/BRAIN TISSUE
• Image 4: Rat brain
  
  Amount and Sample Type:
  500 ug rat brain homogenate
  Amount of IP Antibody:
  6 ug
  Primary Antibody:
  MBP
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat anti-rabbit Alexa-Fluor 594
  Secondary Antibody Dilution:
  1:5000
  Gene Name:
  MBP
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science