OGT Antibody - N-terminal region (ARP49154_P050)

• Product Number: ARP49154_P050
• Name: OGT Antibody - N-terminal region (ARP49154_P050)
• Protein Size (# AA): 1046 amino acids
• Molecular Weight: 117kDa
• NCBI Gene Id: 8473
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
• Alias Symbols: OGT1, HRNT1, MRX106, HINCUT-1, O-GLCNAC
• Peptide Sequence: Synthetic peptide located within the following region: ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Taylor,R.P., (2008) J. Biol. Chem. 283 (10), 6050-6057
• Description of Target: OGT catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Protein Interactions: FBXW11; HUWE1; UBC; PSG1; PHC3; NUP62CL; TET2; SUMO1; NEDD8; WWOX; BAP1; P3H1; RPRD1B; PPME1; LAP3; DBNL; HSPBP1; GPN1; WDR4; ACTR2; TOM1L1; ZPR1; SURF2; LPP; AGFG1; ALAD; C14orf142; UBL4A; FOXO4; HCFC1; SMURF1; Hoxa1; Nfatc1; Nup62; RELA; PPP1CB; PPP1CA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-OGT (ARP49154_P050) antibody is Catalog # AAP49154 (Previous Catalog # AAPY02354)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGT
• Uniprot ID: O15294
• Protein Name: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
• Sample Type Confirmation:

  OGT is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_858058
• Purification: Affinity Purified
• Nucleotide Accession #: NM_181672
• Tested Species Reactivity: Human
• Gene Symbol: OGT
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human 721_B
  
  Host: Rabbit
  Target Name: OGT
  Sample Type: 721_B Whole Cell lysates
  Antibody Dilution: 1.0ug/mlOGT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
• Image 2: Human Pineal Tissue
  
  Rabbit Anti-OGT Antibody
  Catalog Number: ARP49154_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic in processes of pinealocytes and endothelial cells in blood vessels
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec