Search Antibody, Protein, and ELISA Kit Solutions

OGT Antibody - N-terminal region (ARP49154_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49154_P050-FITC Conjugated

ARP49154_P050-HRP Conjugated

ARP49154_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
NCBI Gene Id:
Protein Name:
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ23071, HRNT1, MGC22921, O-GLCNAC
Replacement Item:
This antibody may replace item sc-22625 from Santa Cruz Biotechnology.
Description of Target:
OGT catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OGT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OGT.
The immunogen is a synthetic peptide directed towards the N terminal region of human OGT
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-OGT (ARP49154_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-OGT (ARP49154_P050) antibody is Catalog # AAP49154 (Previous Catalog # AAPY02354)
Printable datasheet for anti-OGT (ARP49154_P050) antibody
Sample Type Confirmation:

OGT is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Taylor,R.P., (2008) J. Biol. Chem. 283 (10), 6050-6057

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...