Search Antibody, Protein, and ELISA Kit Solutions

OGT Antibody - N-terminal region (ARP49154_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP49154_P050-FITC Conjugated

ARP49154_P050-HRP Conjugated

ARP49154_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-22625 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human OGT
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-OGT (ARP49154_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-OGT (ARP49154_P050) antibody is Catalog # AAP49154 (Previous Catalog # AAPY02354)
Datasheets/Manuals:
Printable datasheet for anti-OGT (ARP49154_P050) antibody
Sample Type Confirmation:

OGT is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Taylor,R.P., (2008) J. Biol. Chem. 283 (10), 6050-6057
Gene Symbol:
OGT
Official Gene Full Name:
O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
Alias Symbols:
FLJ23071, HRNT1, MGC22921, O-GLCNAC
NCBI Gene Id:
8473
Protein Name:
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
Description of Target:
OGT catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Swissprot Id:
O15294
Protein Accession #:
NP_858058
Nucleotide Accession #:
NM_181672
Protein Size (# AA):
1046
Molecular Weight:
117kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OGT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OGT.
Protein Interactions:
FBXW11; HUWE1; UBC; PSG1; PHC3; NUP62CL; TET2; SUMO1; NEDD8; WWOX; BAP1; P3H1; RPRD1B; PPME1; LAP3; DBNL; HSPBP1; GPN1; WDR4; ACTR2; TOM1L1; ZPR1; SURF2; LPP; AGFG1; ALAD; C14orf142; UBL4A; FOXO4; HCFC1; SMURF1; Hoxa1; Nfatc1; Nup62; RELA; PPP1CB; PPP1CA;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...