| Product Number |
ARP48081_P050 |
| Product Page |
www.avivasysbio.com/saa1-antibody-middle-region-arp48081-p050.html |
| Name |
Saa1 Antibody - middle region (ARP48081_P050) |
| Protein Size (# AA) |
122 amino acids |
| Molecular Weight |
14 kDa |
| NCBI Gene Id |
20208 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
serum amyloid A1 |
| Alias Symbols |
Sa, Saa2, Saa-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Saa1 is a major acute phase reactant and apolipoprotein of the HDL complex. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-Saa1 (ARP48081_P050) antibody |
| Blocking Peptide |
For anti-Saa1 (ARP48081_P050) antibody is Catalog # AAP48081 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Saa1 |
| Uniprot ID |
P05366 |
| Protein Name |
Serum amyloid A-1 protein |
| Publications |
Zeng, J., Du, S., Zhou, J. & Huang, K. Role of SelS in lipopolysaccharide-induced inflammatory response in hepatoma HepG2 cells. Arch. Biochem. Biophys. 478, 1-6 (2008). 18675776 |
| Protein Accession # |
NP_033143 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009117 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Saa1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 85% |
| Image 1 | Mouse Thymus
 | Host: Rabbit
Target Name: Saa1
Sample Type: Mouse Thymus lysates
Antibody Dilution: 2.0ug/ml |
| | Image 2 | Western Blot
 | 25 ug of the indicated Mouse whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|
|
