Search Antibody, Protein, and ELISA Kit Solutions

Saa1 Antibody - middle region (ARP48081_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48081_P050-FITC Conjugated

ARP48081_P050-HRP Conjugated

ARP48081_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
serum amyloid A1
Protein Name:
Serum amyloid A-1 protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Saa-1, Saa2
Replacement Item:
This antibody may replace item sc-159936 from Santa Cruz Biotechnology.
Description of Target:
Saa1 is a major acute phase reactant and apolipoprotein of the HDL complex.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Saa1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Saa1.
The immunogen is a synthetic peptide directed towards the middle region of Mouse Saa1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 85%
Peptide Sequence:
Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Saa1 (ARP48081_P050) antibody is Catalog # AAP48081
Printable datasheet for anti-Saa1 (ARP48081_P050) antibody

Zeng, J., Du, S., Zhou, J. & Huang, K. Role of SelS in lipopolysaccharide-induced inflammatory response in hepatoma HepG2 cells. Arch. Biochem. Biophys. 478, 1-6 (2008). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 18675776

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...