ABCC8 Antibody - N-terminal region : FITC (ARP43622_P050-FITC)

• Product Number: ARP43622_P050-FITC
• Name: ABCC8 Antibody - N-terminal region : FITC (ARP43622_P050-FITC)
• Protein Size (# AA): 1581 amino acids
• Molecular Weight: 177kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 6833
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 8
• Alias Symbols: HI, SUR, HHF1, MRP8, PHHI, SUR1, ABC36, HRINS, PNDM3, TNDM2, SUR1delta2
• Peptide Sequence: Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Chiannilkulchai,N., (2008) J. Biol. Chem. 283 (14), 8778-8782
• Description of Target: ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: ENSA; KCNJ11; CRYBB1; KCNJ8; RAPGEF4;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Additional Information: IHC Information: Paraffin embedded small intestine tissue, tested with an antibody dilution of 5 ug/ml.
• Blocking Peptide: For anti-ABCC8 (ARP43622_P050-FITC) antibody is Catalog # AAP43622 (Previous Catalog # AAPS15903)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABCC8
• Uniprot ID: Q09428
• Protein Name: ATP-binding cassette sub-family C member 8
• Protein Accession #: NP_000343
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000352
• Gene Symbol: ABCC8
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Image 1: