Search Antibody, Protein, and ELISA Kit Solutions

ABCC8 Antibody - N-terminal region : FITC (ARP43622_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43622_P050 Unconjugated

ARP43622_P050-HRP Conjugated

ARP43622_P050-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application:
IHC, WB
Additional Information:
IHC Information: Paraffin embedded small intestine tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
ABCC8
Official Gene Full Name:
ATP-binding cassette, sub-family C (CFTR/MRP), member 8
NCBI Gene Id:
6833
Protein Name:
ATP-binding cassette sub-family C member 8
Swissprot Id:
Q09428
Protein Accession #:
NP_000343
Nucleotide Accession #:
NM_000352
Alias Symbols:
ABC36, HHF1, HI, HRINS, MRP8, PHHI, SUR, SUR1, TNDM2, SUR1delta2
Replacement Item:
This antibody may replace item sc-25683 from Santa Cruz Biotechnology.
Description of Target:
ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
1581
Molecular Weight:
177kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ABCC8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ABCC8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ABCC8
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-ABCC8 (ARP43622_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
Concentration:
0.5 mg/ml
Protein Interactions:
ENSA; KCNJ11; CRYBB1; KCNJ8; RAPGEF4;
Blocking Peptide:
For anti-ABCC8 (ARP43622_P050-FITC) antibody is Catalog # AAP43622 (Previous Catalog # AAPS15903)
Datasheets/Manuals:
Printable datasheet for anti-ABCC8 (ARP43622_P050-FITC) antibody
Target Reference:
Chiannilkulchai,N., (2008) J. Biol. Chem. 283 (14), 8778-8782

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...