CRLF1 Antibody - middle region (ARP36672_P050)

• Product Number: ARP36672_P050
• Name: CRLF1 Antibody - middle region (ARP36672_P050)
• Protein Size (# AA): 422 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 9244
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cytokine receptor-like factor 1
• Alias Symbols: CLF, NR6, CISS, CISS1, CLF-1, zcytor5
• Peptide Sequence: Synthetic peptide located within the following region: KDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development.Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.
• Protein Interactions: CLCF1; CNTFR;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CRLF1 (ARP36672_P050) antibody is Catalog # AAP36672 (Previous Catalog # AAPP08005)
• Uniprot ID: O75462
• Protein Name: Cytokine receptor-like factor 1
• Protein Accession #: NP_004741
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004750
• Tested Species Reactivity: Human
• Gene Symbol: CRLF1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-CRLF1 Antibody
  Titration: 1.0 ug/ml
  Positive Control: Jurkat Whole Cell